DPCstruct | MC20324
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 252 ± 49 aa |
| Standard deviation of domain lengths | 49.24 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 17.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V1E1Z8 | 3-208 | ASKELNYEMDLLFSHGRPFFSLTWKKFPALSSVVNSVLFNIDLRVRDPYRGGEDSGPRPRTRELALLLEDPKTCFAGSLFDYAAILF… |
| A0A166BK33 | 18-281 | DGLLLTNRLIAHETRAIIERTKPTYKLDLLFVDELQFWPTWTCLPVSAQFIDSVHVSISCLETQVPVLRAFLWSFRGPPQSMWALYV… |
| A0A179HWK8 | 1-358 | None |
| A0A0D2YJB8 | 1-232 | None |
| A0A101M945 | 2-223 | None |
| A0A6G1J256 | 199-522 | None |
| A0A4V1XPT9 | 210-441 | None |
| A0A6A5WF66 | 99-419 | None |
| A0A4Q4T5P0 | 72-316 | None |
| A0A6A5TDR8 | 27-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.