DPCstruct | MC20322
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 149 ± 29 aa |
| Standard deviation of domain lengths | 29.31 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H3DKA1 | 3-110 | PKKRRSEMTEEEKREADLQTTLRKAKSSAKKEWESSLPEPWKGPHNFKWPAGTLVRMYKSDAKRSYGLTEREILTLPCESIEMSSKT… |
| A0A166AW30 | 15-118 | SPPPAKKPRAPRKVVSAEEKTANVLIREKKKAWEATLVPPKADSGFTWPQGTVGMFPSDAKSAFKLTPKEIDTLRREEIQGSRKSFV… |
| A0A2H3D673 | 2-124 | None |
| A0A146HBV7 | 1-143 | None |
| A0A284QWL2 | 19-176 | None |
| A0A4S8LM45 | 174-349 | None |
| A0A166JXH3 | 1-136 | None |
| A0A4Y9Y0T2 | 1-132 | None |
| A0A6A6UFP8 | 1-184 | None |
| A0A2H3E5F5 | 10-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.