DPCstruct | MC20320
Metacluster Properties and Pfam Annotations
| Number of structural domains | 87 |
|---|---|
| Mean domain length (aa) | 211 ± 48 aa |
| Standard deviation of domain lengths | 47.66 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 77.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 37.61 |
| Pfam Score | 98.28 |
| Assigned Pfam label(s) | PF01265- PF16815 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A836BBE9 | 5-182 | PNQLPCPGQRKPLSTERVASNIPKGGTDSTWLFPSPQMVFNALKRKGKGDDVTEDDMDGFIAAHNSMNEATWQRVVQWEVLHRGECD… |
| A0A165ZR45 | 13-220 | PSHGDASSAGCPVAHGDAQTDQSTPHPLPTSAIAPPSLGTQRVTSSIPRATGGNWEYPSEAQFYAAMARKQHNPRATDMAVVVPIHN… |
| A0A3S1BIX1 | 154-394 | None |
| A0A1S8VIR9 | 2-115 | None |
| A0A7S2XZW3 | 4-217 | None |
| A0A0N4W1P5 | 6-190 | None |
| P53703 | 52-264 | None |
| A0A4U0VCE2 | 7-174 | None |
| R1EFH8 | 146-385 | None |
| A0A4Y8DCL4 | 48-309 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.