DPCstruct | MC2032
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 81 ± 11 aa |
| Standard deviation of domain lengths | 11.23 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 30.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A448MN13 | 24-97 | HQFWFAYTKHIVKRVAAVFLQNDRVTTTRLHGHIFSCLLEIPNRVCDNAYGKNSGYANLWTKNIDFVEIDKNDG |
| H1WA16 | 35-121 | MDNPSWHLNSWKFMHDGVYQFKPHGLVITNRLHGHILGILLEIPHVFLANSYYKNQSFYETWTHEIPFCKFVQDASDVENAAREILK |
| V9XP39 | 1-92 | None |
| A0A0Q4D7K3 | 2-70 | None |
| G6E9U9 | 48-140 | None |
| A0A119CWR3 | 79-169 | None |
| A0A5C7FSZ2 | 1-92 | None |
| A0A653R333 | 4-70 | None |
| A0A6B3NN64 | 129-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.