DPCstruct | MC20319
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 79 ± 12 aa |
| Standard deviation of domain lengths | 12.08 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 47.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0158 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I1IQM9 | 4-85 | DLNSDLGESFGSWKMGNDDQILPVVTSANIACGFHAGDPLGILKTVRKAVELGVTIGAHVSYPDLVGFGRRNMDLSRDELIA |
| A0A165ZBU1 | 6-86 | YPVKINVDLGEGYGNFTCGPDEELIRLGLIDHANVACGLHVGDPLIMQQTDKLCKPYNIVVGAHPGLRLRAGRDRDVVRGD |
| A0A0K2RJ48 | 2-84 | None |
| A0A0P9HMP4 | 5-87 | None |
| A0A377Z7C2 | 1-46 | None |
| A0A7S4E3Z9 | 10-97 | None |
| A0A6N8FBN6 | 8-94 | None |
| A0A537U2Z7 | 1-75 | None |
| A0A380FIM8 | 1-69 | None |
| W2S9L6 | 1-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.