DPCstruct | MC20318
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 196 ± 12 aa |
| Standard deviation of domain lengths | 11.86 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 80.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A165PRB3 | 31-235 | TTYARFSADPGRLMEWRDHLELDELSTSTSAPPDVRYARILPYLVKAKDELVRAHGWKDAQHRVDLDTMAFAIEKTVRGASYALAFP… |
| W4JX74 | 8-206 | SRYAYVKFESNNCPWWEDYTGLDALTFKQLELAYARAREFILEQVEVLVKSHGWSPQSGISTAELFSLARGDRTLWLPTAFSAFFDT… |
| A0A0C3C311 | 19-195 | None |
| A0A0C9VM21 | 3-192 | None |
| A0A4Z0A2P4 | 5-201 | None |
| A0A146IGN9 | 3-209 | None |
| G4TCB3 | 3-218 | None |
| A0A4V3XG38 | 56-238 | None |
| A0A0C3F0H7 | 511-693 | None |
| A0A5C3MY03 | 2-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.