DPCstruct | MC20317
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 342 ± 59 aa |
| Standard deviation of domain lengths | 58.95 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 67.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2AJ94 | 1-249 | MPPPLPPEVLQTILTHLLPPTPPLPPDLVSRSLLERLTYLPPDPDDIDSQISPRPVPGLSERLAEIARDCHPSSVDYSHDGEVVIGR… |
| A0A165PNK5 | 1-347 | MAPQPTPFPEYVVNLTLQHLIPPGVSPIPSHLLSSALTQRHNLLQLEPIDPAYYAWPVTDGLEATHSPDPAQVVQALESLNESSALG… |
| A0A5M3N5J2 | 2-334 | None |
| A0A177A1D8 | 9-368 | None |
| A0A367J528 | 14-279 | None |
| A0A0D0SZH0 | 1-264 | None |
| A0A5C2SGS4 | 1-428 | None |
| A0A2H3CM86 | 6-257 | None |
| A0A4V6DI69 | 7-336 | None |
| A0A1X2IIS0 | 14-368 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.