DPCstruct | MC20314
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 470 ± 102 aa |
| Standard deviation of domain lengths | 102.04 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 82.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.39 |
| Pfam Score | 65.00 |
| Assigned Pfam label(s) | PF02026- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A353E5T8 | 106-580 | EFIGLYLLYDDQLQNLAKNIKLRGDEYFKGNMAQKAYIFCRATSGKLNGGTAFEYNSRYGVETILVDAAQLAIKTMMAKRETHPANY… |
| R5AQK3 | 3-358 | TRKPFPTPHIVCFGEADALAETLPLYANSHQSGAYVSNPSKRTRISVVTDDTDFIDDFMFIRKELIENSFRRVVDLRGEIPQVRLYK… |
| A0A1F5VKU3 | 278-765 | None |
| A0A1Y4NA72 | 517-997 | None |
| A0A7C4GAV5 | 89-594 | None |
| A0A518DVH5 | 35-629 | None |
| A0A7W5ZQ77 | 362-906 | None |
| A0A0M1J9C1 | 83-648 | None |
| A0A1G4WXA2 | 8-371 | None |
| A0A1Q6KQC1 | 287-886 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.