DPCstruct | MC20313
Metacluster Properties and Pfam Annotations
| Number of structural domains | 150 |
|---|---|
| Mean domain length (aa) | 229 ± 64 aa |
| Standard deviation of domain lengths | 63.86 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 83.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 16.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0322 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A353E2X1 | 44-278 | SKFKHGVQNFKAQLPSNVLALQVNDDFGDTSSLLITMATEAILDDDADKYSVYFPEAVIKFKQLSYNEASSPIEVRLSNTNEKVLTG… |
| A0A498F6S3 | 3-149 | NLGYDELYKATQALQAKAWGTPQLAGVFSSYQINVPQLFADVDRVKAKQLGVPLSTIYQTLQVNLGSLYVNDFNQFGRTYQVRVQAD… |
| A0A1E4HTX1 | 13-166 | None |
| A0A212DW87 | 17-209 | None |
| A0A3N9NF38 | 450-643 | None |
| A0A378MZE4 | 70-323 | None |
| A0A244C5R0 | 1-151 | None |
| A0A830Y7U9 | 2-210 | None |
| A0A0B8NX60 | 4-184 | None |
| A0A532E860 | 31-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.