DPCstruct | MC20312
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 96 ± 10 aa |
| Standard deviation of domain lengths | 9.55 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 69.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 53.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498NCK7 | 1-84 | MKKEKPLIQHPTDPISTQTEMPVPQPLFDDRSMNLSEKEIVDLFEKMMEDMNLNEERKAPLRGKDLSTKREMVVQYISATAKSA |
| A0A1U7SP25 | 1-93 | MADELERLTSMRIKKEKERPNASHRNSSASYMDVQSTGQTLQEIPDEDVLVLFEQMLVDMNLNEEKQQPLREKDIIIKREMVSQYLH… |
| A0A3Q7RRS8 | 48-156 | None |
| A0A060WKX9 | 52-133 | None |
| S9Y246 | 4-87 | None |
| M7BUZ6 | 25-115 | None |
| A0A7J8AU06 | 56-158 | None |
| A0A4W3GDB8 | 22-122 | None |
| A0A7J5X7H6 | 30-139 | None |
| L5MF82 | 21-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.