DPCstruct | MC20310
Metacluster Properties and Pfam Annotations
| Number of structural domains | 150 |
|---|---|
| Mean domain length (aa) | 220 ± 47 aa |
| Standard deviation of domain lengths | 47.38 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 86.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.18 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | PF02602- CL0304 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D3SMG8 | 2-235 | KKRAALCGSRKKEEFLKMMAETDIEAYVEEVVTIEYLPAEEVAKKLEEVLSLKPSHFLFTTGEGVQRLFQVAEEYGVLPHLLQLLKN… |
| A0A1U7S6W5 | 1-217 | MKVLLLKDPKERDSGPDPYIQELGSYGFEATLIPVLSFEFVSLQSLFEKLSHPECYGGLIFTSPRAVEAVKLCLKENSKNEAWTKSL… |
| A0A8A5ZFZ4 | 1-161 | None |
| A0A6L5C411 | 177-388 | None |
| A0A1F2UZA8 | 6-209 | None |
| A0A7J0EKA1 | 42-295 | None |
| A0A0D6R6F5 | 2-161 | None |
| A0A7W2CC15 | 13-231 | None |
| A0A2E3K4A8 | 10-227 | None |
| A0A838YX42 | 2-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.