DPCstruct | MC2031
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 320 ± 48 aa |
| Standard deviation of domain lengths | 47.99 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09692 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V1STU8 | 17-295 | GNDENWEVDFEAVVKGFLSRTMTDWCMYDRVAIQLAADIVKNFLNYVLMQDVCPEYASNIVAARGICDIAPTELRHVHELSSQLPGD… |
| A0A0D2FJA9 | 8-368 | FGSVEVGPNAHQGGQGQGQDRDTEDMDKTQLLAAMSQASVSDDKRHLGTATSLYDVDFQGVMKAFLSRRARLLYGFELRDQVSTLTT… |
| A0A4P9Y480 | 54-326 | None |
| A0A162I737 | 1-271 | None |
| A0A261Y4V4 | 92-434 | None |
| A0A4U0WJB5 | 198-510 | None |
| A0A4U0WBE2 | 12-334 | None |
| A0A367KI13 | 324-629 | None |
| A0A1Y2GZK2 | 4-271 | None |
| A0A2T3ANG2 | 38-407 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.