DPCstruct | MC20309
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 158 ± 13 aa |
| Standard deviation of domain lengths | 13.00 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0053 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J8VW33 | 6-159 | QSEECTVTGFLRDKLQYRSRLQYMKHYFPINYKISVPYEGVFRIANVTRLQRALVSERELRYLWVLVSLSATESVQDVLLEGHPSWK… |
| A0A1U7S317 | 21-177 | MQKECEIVGILQDKLKYKERLQYMKYYFPLNYTVTVQYEEVLRTSNVSRLRDEAITEPSLRYLWFHVSSQVVLKIRDVLPEQHPSWS… |
| A0A0P7V2M4 | 18-188 | None |
| A0A4Z2I1K5 | 31-194 | None |
| A0A151NJQ4 | 88-244 | None |
| A0A643CHV7 | 6-166 | None |
| A0A6J2ARP9 | 17-156 | None |
| L5MCR9 | 17-183 | None |
| A0A4D9DR15 | 2-155 | None |
| A0A3Q2V2R4 | 9-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.