DPCstruct | MC20305
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 151 ± 6 aa |
| Standard deviation of domain lengths | 6.13 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 76.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 22.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832BS74 | 1-153 | MSILITYLVKLSISLAVVYLFYQLVLRRLTFYNWNRWYLLVYSLLSFFIPFINISPVLEKNNLANHEVLQLIPSLSGSALNSTPPEK… |
| A0A831LRJ8 | 1-155 | MEALISFLIKSSAGIILFYLVYWFFLRKETYHNANRWFLLAVLFTSVLLPLFPVHYTLLVEQGNNSNLFVTIPDTFKHIPAVTGQEP… |
| A0A4R6INI6 | 5-150 | None |
| A0A5S3PTR6 | 2-148 | None |
| A0A5C7BHW7 | 1-143 | None |
| A0A839GMM7 | 3-161 | None |
| A0A1M5FGF7 | 2-164 | None |
| A0A1G7G1A8 | 1-148 | None |
| A0A3L9Z2Q1 | 1-146 | None |
| A0A3G2GBH2 | 1-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.