DPCstruct | MC20300
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 126 ± 21 aa |
| Standard deviation of domain lengths | 21.01 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 90.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 44.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03692 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M5MJ13 | 2-121 | CDGCGLCCLQKLEDEDDNSVYYTRIACKLLDLKTCQCTDYPNRRASVPDCIQLTPGQADQFKWLPPTCGYRLVSERKDLPLWHHLVC… |
| A0A3M2BU32 | 4-128 | FWKTKTLDEMTSEEWELLCDGCGRCCLRALEDESGKIFRTQIACRLLDTETCRCKKYDERFVQVPECLELRKLSRSKYHWLPESCAY… |
| D0XCR7 | 1-107 | None |
| A0A2N6DRM0 | 6-95 | None |
| A0A4R0NYF9 | 298-444 | None |
| A0A2D6PQJ9 | 1-111 | None |
| A0A6I4SRM7 | 199-341 | None |
| A0A1T4L2Z7 | 42-127 | None |
| A0A4R0Y6D2 | 5-143 | None |
| A0A2A2K322 | 185-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.