DPCstruct | MC2030
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 162 ± 20 aa |
| Standard deviation of domain lengths | 19.92 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A8DWC5 | 9-142 | ETSVNRTKDDLKLVEKLSVINHPTTEEDKVLDYCLRHYHQGLLYYKQGEWSNAEKQWLKILKKMPNHVGDRLDILYRKQRRYKNEID… |
| A0A855VBI4 | 1-197 | MGFFDNLIRHAKSLETNKPIKNLAIQKTSREVRPNTKIKKSPQTVRKNPNTGFPMAKETSIQRAREMYKQTISISKYKPSGNKKLDY… |
| A0A2G9VNH3 | 341-482 | None |
| D0R3L4 | 117-257 | None |
| A0A1Y0FAG5 | 9-167 | None |
| A0A087QER2 | 2-166 | None |
| E3C5B9 | 61-217 | None |
| U4QIK7 | 117-285 | None |
| A0A1B2IPN8 | 1-194 | None |
| A0A7H9EAZ4 | 2-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.