DPCstruct | MC203
Metacluster Properties and Pfam Annotations
| Number of structural domains | 142 |
|---|---|
| Mean domain length (aa) | 112 ± 12 aa |
| Standard deviation of domain lengths | 12.37 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15024 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1LU74 | 15-115 | LWRPHPQRQVAKAQPGDSCDGHCRRLGMRCEARELEFVNSCEALQREFPCEDGCGHQVGQEIPAYVHDRTRDTALQCLVTDDAIPTC… |
| A0A7S1HVV6 | 25-134 | VLRQKNVVLQNMVLRSGHPDQSCSRVCEKASLECHEPGLQYTPVNRCETIEKALQVKCDKCDLDSSDRHAPSFRVRENRCVVNYLHD… |
| A0A7S0MH86 | 2-98 | None |
| A0A7S4S2B5 | 24-148 | None |
| A0A7S4NDP5 | 118-221 | None |
| A0A7S4P8V5 | 410-522 | None |
| A0A7S2ST87 | 33-149 | None |
| A0A7S0MI16 | 95-195 | None |
| A0A7J6KTR8 | 649-746 | None |
| A0A7S2AC65 | 201-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.