DPCstruct | MC20297
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 472 ± 71 aa |
| Standard deviation of domain lengths | 70.79 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 14.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M2BAI0 | 2-479 | ALKIPEYQQTERSTPLRPYAEPRVINPAAGLTQGLSHLGSALQEAEKKRAQLEAEDALQQFVRQTNDLLLSGQNPYYGTKGKDAVNG… |
| A0A521M551 | 3-434 | ARQIDTEFSSGVRALLHAPETGIAAQSGEAALEAIASALPALNELKERTLSQAMGPRQRGIFEPLIETRLDWAAGTLGRLAERATVE… |
| A0A160TL59 | 16-452 | None |
| A0A7X8YBY9 | 1-348 | None |
| X5YR70 | 17-559 | None |
| A0A364NVZ7 | 15-537 | None |
| A0A0F9I5Y0 | 16-503 | None |
| A0A2V2G6B4 | 39-570 | None |
| A0A5C1WEK1 | 1-562 | None |
| A0A521QV92 | 31-519 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.