DPCstruct | MC20289
Metacluster Properties and Pfam Annotations
| Number of structural domains | 107 |
|---|---|
| Mean domain length (aa) | 176 ± 33 aa |
| Standard deviation of domain lengths | 32.67 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04468 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q4DEY8 | 166-334 | WPKNNCFILLVEFKCQRVKRCESNFFIVPGQYAIVQGDRGYDCGVVNQCSEWNAEKGCFVREESLDGTMVNVARMKSDMSRVLRVAS… |
| A0A0U9HXQ9 | 3-161 | NVVHVRVRPFGKVYRYLNNLGIELKKGDFVVVEGDFGLTLGYVIKTSFDSENTFKPVIRKATNEDMDDFQKNLLLEKEAWDFCLQRI… |
| A0A177VKN6 | 790-1018 | None |
| A0A0S4JG31 | 240-387 | None |
| A0A5C4TFV3 | 32-159 | None |
| A0A849IQP1 | 1-208 | None |
| A0A7C4R180 | 325-504 | None |
| A0A7S8HGG0 | 333-488 | None |
| A0A7S2RPH9 | 581-733 | None |
| A0A832C410 | 170-376 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.