DPCstruct | MC20288
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 78 ± 5 aa |
| Standard deviation of domain lengths | 5.12 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 31.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7HBR6 | 2-90 | VARLDDMAALPFWPRFLSREQAAAYLGVSTTTFDEEVNAGIWPPGVRRGAREGRITWDRVAIDRAVDSGPFASKMQEAEDDDYDRRR… |
| A0A2P8NKF3 | 1-74 | MKPGLHYAPLGMSREEAARYVGVGTTTFDRMVAEGVMPRPKRYRGRVLWNRVALELAFEDLPENEGNMIDKILG |
| A0A5C7PFU2 | 17-90 | None |
| A0A7W8X755 | 79-157 | None |
| I9LKL2 | 6-83 | None |
| A0A285MAD2 | 1-72 | None |
| A0A0S2EX50 | 5-80 | None |
| A0A1I2GY26 | 4-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.