DPCstruct | MC20287
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 122 ± 9 aa |
| Standard deviation of domain lengths | 9.19 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 19.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661WMD2 | 326-430 | SGEWNSELSSGDPSSKAVAIDVMTNPTRVAFSHTDIGNNGHATELDAVAIGSIITVMETNDNTRSFTCEVSAISTAPASSTTYTVIN… |
| A0A1X7GN90 | 69-189 | IGMVWDAATTVADPGAGNLRATTATPAVGSYSLLVSATDSAGADIGAMLTELGASSSAIRARARLVAVGDAAKYLDLRITGVTGVGA… |
| A0A5C7Q3R6 | 351-465 | None |
| V7H421 | 221-329 | None |
| A0A503PAB9 | 226-352 | None |
| A0A368YKK5 | 238-346 | None |
| A0A535A8I4 | 188-307 | None |
| A0A530YYK6 | 117-244 | None |
| A0A2E5JQH3 | 183-311 | None |
| A0A2R4ME91 | 98-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.