DPCstruct | MC20284
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 156 ± 20 aa |
| Standard deviation of domain lengths | 20.47 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y4BLZ8 | 1-138 | MRLAANKMSALSVLRSIRSTRGRLGARCELPVPDSSPRKRLSAATLPLRALALETPPDRRHPLHVAVPSRDARVQASFAACTVYSTG… |
| A0A1Y3USD5 | 1-144 | MSIVLSHSAVRLLYRAPARPRYLPKFPGVSSPLKTGAPQADEVARARALLISYGIPASKLETLELLVSEPKERRRMPGIKCHVCRHE… |
| A0A316RU19 | 1-167 | None |
| A0A173XWT1 | 1-151 | None |
| A0A415CY12 | 3-183 | None |
| U2V5J0 | 1-180 | None |
| A0A437UY90 | 10-156 | None |
| A0A316S733 | 1-138 | None |
| A0A2V2EPW5 | 151-300 | None |
| A0A7X5IDQ2 | 92-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.