DPCstruct | MC20280
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 87 ± 15 aa |
| Standard deviation of domain lengths | 15.35 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 72.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.73 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G7EIJ4 | 1-74 | MEPIFKENPQLDVVYKTSDGKYFYTENDAKNYASNLEDKKVKKLVRGEDKSEKVEETATEDVAEPNKKQTKTKK |
| A0A2P8EAP5 | 6-98 | KLADIAKMVFAAHTAAKVFYFTSDGQAFSEKSDAVNHGRSLEDKEVTEVTRAMAVSGNISFASSEQKSVNEDQGKAKNEFQATGTRS… |
| A0A085ELC9 | 1-73 | None |
| A0A250FKL3 | 1-80 | None |
| A0A4P7VYU6 | 1-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.