DPCstruct | MC2028
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 118 ± 9 aa |
| Standard deviation of domain lengths | 8.65 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 49.41 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0063- PF20465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A381FDA2 | 7-118 | SKRRKTLIELGELNWKDINPDIFGSMIQAVVIPEYRSDLGMHYTSVENIKKLIKPLFLDELYEVYENATTVNHLRALIKRISKIKFF… |
| A0A349EIE3 | 44-156 | RRRVASFEALDWSRISPAIFGSLFQSIMDTRARRHLGAHYTSEQHILKALQPLFLDRLRQEFQQARRNPRRLLDFQRQLATVRVLDP… |
| A0A251WP45 | 21-133 | None |
| A0A0K8QIM3 | 7-122 | None |
| A0A365TXA6 | 125-253 | None |
| A0A847A0R4 | 146-276 | None |
| A0A379I7Y4 | 127-243 | None |
| A0A5Q2RXF7 | 156-282 | None |
| A0A2S6YZL9 | 85-190 | None |
| X5ES37 | 143-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.