DPCstruct | MC20279
Metacluster Properties and Pfam Annotations
| Number of structural domains | 83 |
|---|---|
| Mean domain length (aa) | 329 ± 73 aa |
| Standard deviation of domain lengths | 72.60 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 90.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.04 |
| Pfam Score | 98.84 |
| Assigned Pfam label(s) | CL0027- PF00368 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A9VQ21 | 13-240 | DYRHVMNACCENVLGYVSIPVGYAGPLMLDGAKYFVPMATTEGALVASTNRGCKALSVKGVTSYVEDVGMTRAPCVRFSSISRALEA… |
| G4QL28 | 143-468 | IIKKRQEYVSGITDTTPQNLFNFDADLASLSGNIEHFCGMAQIPIGIAGPIKVNGEHAQGEFLIPLATTEGTLVASYNRGIKLLNQS… |
| D6PBZ1 | 2-204 | None |
| A0A0D8XV37 | 87-459 | None |
| A0A1Y2PCR4 | 24-370 | None |
| A0A812IWS4 | 68-421 | None |
| A0A7H0FQV5 | 402-746 | None |
| A0A0P7GMD0 | 22-263 | None |
| A0A177X015 | 52-451 | None |
| A0A1Y2HJ60 | 452-861 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.