DPCstruct | MC20277
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 128 ± 11 aa |
| Standard deviation of domain lengths | 11.48 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 52.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01496 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W6F9S4 | 196-326 | FYNRLPSSSSSSPPPTLFTTNSFTAAFQSIVEAYGVAKYREVNPAVYTMVTFPFLFAVMFGDVGHGLLMAAAALWMILQDNKNTPSR… |
| T1GG72 | 15-124 | VNKFTKAFQAIVDAYGVPNYKELNPAPYTIITFPFLFAVMFGDWGHGLIVFCLSLYLIFNEKNIAKADLNDIFKIMFDGRYIIMMLG… |
| A0A7F8QZM3 | 1-116 | None |
| A0A1Y3BIB0 | 1-138 | None |
| A0A821QEU5 | 94-227 | None |
| A0A182F8F2 | 777-916 | None |
| A0A0C2JFI5 | 326-463 | None |
| A0A6I9YPB8 | 184-320 | None |
| A0A4Z2EDQ7 | 115-249 | None |
| A0A6G0HWL9 | 422-547 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.