DPCstruct | MC20275
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 151 ± 17 aa |
| Standard deviation of domain lengths | 16.91 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 47.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2SP94 | 199-366 | CTEYPGQRAGKEVTTNPGYASVAGRVDVEGCCWWGRGVIQTTGRCNIGKLNYYLGKRAADDGRSSRYPSLDFCRNPNAICDDPNHGD… |
| A0A0B8Q6U4 | 35-199 | SSQQSVQGCGWWGRGVIQTTGRQNFGTLNHFMGRSHVDPDTIGTTVDGVVVEAAPQNPLYADMDFCSNPGLICSSEENREIKWIAGL… |
| A0A2T3JC11 | 627-784 | None |
| A0A7S0LAS5 | 198-343 | None |
| A0A812SVS4 | 259-393 | None |
| K0SE72 | 256-410 | None |
| B8LE24 | 1097-1225 | None |
| R1FG73 | 828-971 | None |
| B8C132 | 785-910 | None |
| B8C3U4 | 303-479 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.