DPCstruct | MC20273
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 81 ± 5 aa |
| Standard deviation of domain lengths | 5.16 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 57.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X0KP73 | 2-79 | NLHFTGDFHAITTAHNLLSALIDNHIYWGNELNIDTRRVVWRRVMDMNDRALRQINCSLGGVANGFPREAGFDITVAS |
| A0A0B8PZL8 | 1-95 | MDELNLHLTGDIHAVTAAHNLASAALDARIYHEQRNGYEDFEARTGMRALKIDPEHIVWKRVVDHNDRALRKITIGLNEPGKTINGF… |
| A0A5S9ME17 | 43-120 | None |
| H8MUY0 | 108-183 | None |
| R5Q2S8 | 119-200 | None |
| X1JJI6 | 83-164 | None |
| A0A327XVL9 | 2-75 | None |
| A0A2J6WKR4 | 270-351 | None |
| R7DB21 | 1-82 | None |
| A0A259UPA2 | 1-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.