DPCstruct | MC20271
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 160 ± 28 aa |
| Standard deviation of domain lengths | 28.07 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20419 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B8PMQ3 | 22-253 | NARLAQYTTDFMMQKLSTNSVGNYTTTPDGPYNSENAEFGLVVSKIVDNVNFNTLDLDDRGVKFTQQPDFRYGRMSLQDIGGNSDQD… |
| A0A1Q3VQJ2 | 594-759 | TDTDGVTSQGYTEGETNIYSGRLWLGNAHGSELLPLPIPVEAQFWQAGGYWATNSLDNCTSFQISAVGLSNPTQNISLCKTQFSPSG… |
| A0A7Y1TAG8 | 1-137 | None |
| A0A1G8DBL7 | 10-166 | None |
| A0A1I2CPJ1 | 5-142 | None |
| A0A2N0XZ08 | 1087-1261 | None |
| A0A2D6MUC3 | 69-210 | None |
| A0A1F3WY49 | 96-243 | None |
| A0A521ZYV7 | 485-637 | None |
| A0A7H4GR14 | 1019-1205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.