DPCstruct | MC20270
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 101 ± 14 aa |
| Standard deviation of domain lengths | 13.83 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.74 |
| Pfam Score | 40.00 |
| Assigned Pfam label(s) | CL0689- CL0022- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E3VYY1 | 123-218 | IPFVSTWRVGDAGYGDGDLTVTLPLRSGFNYNFTVDWGDGKTDEVTAHNDSDIDHLYDSGGDYTITISGLVEAWYFNNAGDKDKIIS… |
| A0A0B8PKU5 | 129-217 | SVVEPRPFITTWKIEADNDEVIIPTRSSRYTYDYNIDWGDGTIEENQTGDVRHTYTLPGTYTISINGVFPNLTTLGGSEKLPMLSLE… |
| A0A661IQR1 | 262-347 | None |
| A0A2E3W278 | 122-209 | None |
| A0A2T6B932 | 10-121 | None |
| A0A0F9CBA7 | 11-116 | None |
| A0A3G2LAY5 | 1-107 | None |
| A0A6G2KV53 | 4-103 | None |
| A0A6N7EXC4 | 59-154 | None |
| A0A2R7RJ73 | 148-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.