DPCstruct | MC2027
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 90 ± 7 aa |
| Standard deviation of domain lengths | 7.14 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M7KC44 | 129-212 | GFQQIISKNNYFTIEQVYCKDFMFTQSYTTFKINDDETVTLHRYGEDYTDRSNPDKNIKGISLATKDFGEIKFENVNIEFLRKL |
| A0A381F7Y0 | 1-101 | MNENILSPVLGNSTGTGLIDIVCKNGYITFEENISEGSPSQNKYITFFYNKNDAHIYLHKYGIIAMYDDDSKDWEKTYISKNFGKIN… |
| A0A418QN50 | 1-93 | None |
| A0A0C1DLY0 | 255-341 | None |
| A0A250FNT9 | 391-473 | None |
| A0A2N9PEI4 | 326-423 | None |
| A0A2N0HIE3 | 92-191 | None |
| A0A1S9AZ23 | 65-154 | None |
| C2M4Q1 | 3-86 | None |
| A0A1H2T1L5 | 277-370 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.