DPCstruct | MC20269
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 285 ± 43 aa |
| Standard deviation of domain lengths | 42.84 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 91.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 43.30 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF00330- CL0364 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B8PJG4 | 3-272 | VSTDEPGTIGPIQQIEELQKDGIPLAYVGDVVGTGSSRKSATNSVLWFMGEDIPFVPNKRTGGICLGGKIAPIFYNTMEDSGALPIE… |
| A0A379U3E2 | 16-338 | AWSRPDIPLHAQAMLKNAREGIEPDQPGVVGPIKQIEALAKKGFPLAYVGDVVGTGSSRKSATNSVLWFMGDDIPFVPNKRGGGLCL… |
| A0A2G1C2D4 | 86-440 | None |
| A0A379V0Z3 | 1-225 | None |
| A0A812QR35 | 222-537 | None |
| A0A1F5YXK9 | 97-366 | None |
| A0A3E2W866 | 56-305 | None |
| A0A1G1CBM3 | 49-315 | None |
| A0A812RLG3 | 164-427 | None |
| A0A0B7IYJ2 | 650-973 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.