DPCstruct | MC20267
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 306 ± 50 aa |
| Standard deviation of domain lengths | 49.54 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 28.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A317W758 | 7-318 | PPQDLWPGGIPTQIHLDNGPGLDYEEMAEASKGWCLFVQVSTPNCPCSSRNIQFWLRIVQSYYSRAPLPPSALHYPPSLLHRSRSRP… |
| B8M8J1 | 7-244 | YPAEALAHVNDTLRPGDINGLVSIASVDEAHAANRARWVKFAILLYNYDIDTGHCLLDNYMPSEAILNPETTTNPSIEDFLSWQDLE… |
| A0A397H8C2 | 212-534 | None |
| A0A423VJ96 | 26-294 | None |
| A0A093Y8U6 | 79-419 | None |
| A0A4Y8DEZ1 | 2-195 | None |
| A0A194W333 | 51-377 | None |
| A0A364KQU8 | 6-392 | None |
| A0A100IPJ3 | 765-1088 | None |
| G3Y5N9 | 137-432 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.