DPCstruct | MC20266
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 111 ± 11 aa |
| Standard deviation of domain lengths | 11.20 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A317W741 | 3-101 | FTEHIVYWDVKPFDDWFEPSDAFTAQTGITHWAVSSESRSGIYRYILWIFLESGASGFGRDYRFVDESGDTYCLTCWTDGNHSLNYN… |
| A0A5C3KNB8 | 95-182 | GIAVDWPVTSDWVATTPEVYKVTSITRYNLKYDPKAFAYNYTLEITNKGSYAFEIYDETGDMYGLGALQPGTHWLWFNSKQPTIKFIT |
| A0A197JTK2 | 3-122 | None |
| A0A5M3YXT8 | 50-167 | None |
| A0A1Q3ZG74 | 2-99 | None |
| A0A5N6U5S2 | 17-119 | None |
| A0A2T6ZSD0 | 26-127 | None |
| A0A4Q4XDA9 | 1-124 | None |
| A0A5C3KUD7 | 91-211 | None |
| A0A5E3X2Y5 | 517-628 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.