DPCstruct | MC20265
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 172 ± 22 aa |
| Standard deviation of domain lengths | 21.95 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q5T9G6 | 4-197 | SLPSLPVKHHDFVQYIQSHPETPIEELVKPYNAFDASARKIFAQDPAHALVKDNFANIVPIFDTTTGSTDIRVRARDLSAETPEQKE… |
| A0A317VYK1 | 1-164 | MASTLTLPQLPAKHRDLPRWIQSHPKPPLNQITAPYNNYDAVVRKLFAQDPSHTALQDNHLNIVPLYDSSGLTDVRVRARDLASEPS… |
| M7TQF8 | 15-165 | None |
| A0A094GGX6 | 11-226 | None |
| A0A4Q4TU81 | 14-155 | None |
| A0A0U5CKP7 | 2-143 | None |
| A0A409WSS8 | 396-590 | None |
| A0A409VV02 | 2-203 | None |
| A0A318YSW4 | 19-179 | None |
| H0EFT6 | 10-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.