DPCstruct | MC20264
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 211 ± 20 aa |
| Standard deviation of domain lengths | 19.59 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5M9ME20 | 284-482 | LKRELRTYLLAHATQAEDSTRFERRASQVSTFTSTKTNTFFNWVRTISADHISCPYAFAFVSCLLGASLTSRGGGGDCFPTIGEKYL… |
| A0A317VCP2 | 26-241 | KKQLLVDLRLFFLSHLDQLDDNEQLQKDRTCTQPHASYLTLSAKPRHSSLFNWIQMTSGHHTGGAAALSFLLCLAAAGNNALPSPRA… |
| A0A6A6IDY6 | 428-623 | None |
| A0A0N1J2B6 | 727-928 | None |
| A0A132B3W2 | 5-187 | None |
| A0A1L9VTD9 | 293-496 | None |
| A0A5N6FH98 | 131-351 | None |
| A0A0G2HTT8 | 185-441 | None |
| A0A0G2F937 | 351-577 | None |
| A0A1Y2TP76 | 742-970 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.