DPCstruct | MC20263
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 87 ± 6 aa |
| Standard deviation of domain lengths | 6.37 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 26.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D4KC83 | 8-99 | KQVTDWMINSISDWMVESGTRSTTEGNWIIYIYEITRKFNVTKNWVTAFRDEIVDALYKHEAVADVLYDFSPDGTVEDFDIDFYLSF… |
| A0A3A6K8Q4 | 3-93 | ARNYVPAMVKWMVEEGTKNTSSGNWIFTSAEIAEAFPVAESSVIEMFGAILTEVYQHEAVAEANVNFESDGSATFDLTFYTDYCPNI… |
| A0A096DA96 | 98-184 | None |
| A0A7X9BTZ5 | 3-83 | None |
| D4KC96 | 1-98 | None |
| A0A413R0M4 | 3-72 | None |
| B0PFI3 | 97-185 | None |
| Q97JW9 | 57-143 | None |
| A0A316RWP4 | 52-137 | None |
| A0A6N2RXX1 | 93-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.