DPCstruct | MC20262
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 89 ± 16 aa |
| Standard deviation of domain lengths | 15.79 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 92.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 37.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14393 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R6YY32 | 2-86 | GNIKILISCHKQSIVPDSEIMLPIEVGADLRSKHIEGYIQDNSGDNISVKNKMYCELTAQYWAWKNLDADYYGFFHYRRYLNFSE |
| A0A510U5W1 | 1-81 | MIVVATHKEFNTSILNDIYVPFRVGAVNKNSDFGYCRDDVGHNISIKNPNFCELTALYAAYKNNADDFEYLGLVHYRRFFC |
| A0A1I4IAV3 | 277-354 | None |
| A0A416PQ43 | 2-88 | None |
| A0A1Y4TNP8 | 472-558 | None |
| A0A0D0SG07 | 2-82 | None |
| R6RCZ0 | 9-89 | None |
| A0A395Z4T3 | 1-85 | None |
| A0A174ZUJ9 | 4-91 | None |
| A0A1B9M524 | 262-409 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.