DPCstruct | MC2026
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 106 ± 13 aa |
| Standard deviation of domain lengths | 12.56 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 19.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G4J844 | 1-107 | MTKEYLQAQDECSPSAFRQFPPNTIQVFMPRTTAIRVPTGGSKCESRAEDNRVKTKCEPEWRTEYRTYQSLEFIDTNAEPRDAVMRS… |
| B6BDM1 | 13-129 | LLLGAAACGPLPVYYRQGAEVSRLRSDELICQAQALKDAPVANEIRQHPPVFYPGRKVCHGGDCYYHPGYWVEGSIYTVDVNKPLRK… |
| A0A8B3KYV7 | 10-129 | None |
| A0A656HC47 | 10-124 | None |
| A0A6M7WQ21 | 1-109 | None |
| A0A6B3JD40 | 18-113 | None |
| A0A0P1F5A0 | 9-113 | None |
| B2FPP6 | 48-161 | None |
| A0A7C8DU35 | 27-111 | None |
| A0A7Z1BM67 | 41-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.