DPCstruct | MC20259
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 141 ± 12 aa |
| Standard deviation of domain lengths | 12.17 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5F0VT86 | 1-122 | MSAYVVDRFHISAILMFTCTGRPGREAREILETQGQQLLDENVRSVRVRYPRENTPDKLFLLDTDVRRLSALEVLKLIECLEHQSSE… |
| A0A317CGI9 | 1-130 | MSAYVLPDEHISYLVSAAIQYQIIQDTPLEINRIGEVLLKENHKSVAYRYREKFDEEERYSFTFYRLETQWPQVLSACKCWNYQACE… |
| M1FUZ3 | 83-228 | None |
| A0A2E7W8I3 | 1-132 | None |
| A0A1I5AZ98 | 1-139 | None |
| A0A7W5AK16 | 1-143 | None |
| A0A1H8YQM3 | 1-146 | None |
| A0A3M3G7J4 | 33-153 | None |
| A0A829HN71 | 1-142 | None |
| A0A1B2ERT9 | 1-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.