DPCstruct | MC20257
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 226 ± 24 aa |
| Standard deviation of domain lengths | 23.56 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 33.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A420ESP5 | 34-263 | MGHGAMNMAPAGIPLAIGGEDRDGLELDALHVRLGPVLAHWPAGLVLRCTLQGDVILDADASLIDADQPVAEDDGRGSTRPLFAARR… |
| A0A5S4GBI4 | 89-275 | GAEMADRADDRDGLRLDVLHVPLGPVLPYWPAGLRVDLTLQGDVVQAADAIAVDRADATFWTDDRRVAARLDSLSRFLRVAGWDAAA… |
| A0A6N8GAK9 | 244-490 | None |
| A0A1G9A4T0 | 64-309 | None |
| A0A854IEP3 | 1-232 | None |
| A0A4R7W5E6 | 127-352 | None |
| A0A7Y9DT85 | 111-315 | None |
| D2SDF8 | 322-585 | None |
| A0A455UMG1 | 10-208 | None |
| A0A428YC06 | 174-397 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.