DPCstruct | MC20254
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 84 ± 8 aa |
| Standard deviation of domain lengths | 8.25 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05166 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N5C2M4 | 1-80 | MFITIHRHGPRALFVRAGTPVSEVPLYALHWLGTIESTADAELKADTPMLGLSPPAILYDITVHGFCVLDVPDISAVTPP |
| A0A5C7KXP5 | 6-89 | PLRCAVYRCARQSEMYLYLREGLKTDELPAPLLQRMGRLTHVMDLALTPERKLARAETARVLDALRGTGYYLQMPPQGHLEAHL |
| A0A258N3Z4 | 14-106 | None |
| A0A2I8QWU0 | 25-115 | None |
| A0A653B6D5 | 8-92 | None |
| A0A2E9NUC9 | 2-78 | None |
| A0A7G1Q8C1 | 202-282 | None |
| A0A349X3L3 | 8-115 | None |
| A0A838ZY45 | 1-73 | None |
| A0A6S6S039 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.