DPCstruct | MC20250
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 113 ± 7 aa |
| Standard deviation of domain lengths | 7.49 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H2QVI2 | 1-99 | MGLTAWLASDDTGTSSRYMAAILSGQFNAPNHYPLDPADLGRCIRLLEAAPELESELHKMKSCSPQWRSVVDNWNKWKDLYEAGKGG… |
| A0A5C7KG21 | 129-237 | LPTSVQKWLATGNRGRSSEAMCRAIFGVPVDGDGSGWRHPLDADDFRRCLGFLKAVPEARKQLVLIADKSPTWASLVEHWGELEALY… |
| A0A0F9S9D3 | 3-109 | None |
| F2LSD4 | 17-129 | None |
| A0A0B1RU46 | 9-122 | None |
| A0A0E3BB61 | 45-160 | None |
| D3SGL3 | 65-186 | None |
| A0A1U9LJF2 | 26-151 | None |
| A0A522KZZ2 | 75-205 | None |
| A0A1J5IEI7 | 6-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.