DPCstruct | MC2025
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 162 ± 17 aa |
| Standard deviation of domain lengths | 16.68 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T2BV47 | 34-179 | DIGPRLADIREMISGGDFEQPRVEPSTYDIWLDARLATGRDETWLASHSLYAGTTFCRLLGAELVRHADPSNVGNLRAAQAAGFEVA… |
| B6BD70 | 2-179 | LACLPAEKFNKDARDFAAQLQKHHGWILDQPVVQANSSPFEAYLTNRILSGRGDRWIDRLELNVASRACEVLGLRIAKGPDAALAGH… |
| A0A212A9J7 | 4-166 | None |
| A0A1L9BPF1 | 99-285 | None |
| A3JXK6 | 107-302 | None |
| A0A546Z3N3 | 4-156 | None |
| A0A239HLL2 | 210-359 | None |
| A0A1H0M296 | 145-310 | None |
| A0A369U7U4 | 176-305 | None |
| C7D887 | 1-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.