DPCstruct | MC20248
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 171 ± 12 aa |
| Standard deviation of domain lengths | 11.68 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A522KQT6 | 1-153 | MDALGVDVVVQAEATPGRWAVYQAGGWQPLEWMASTWRTVAEPSVGFRYNITAHLVGNLLDLPFDGQSAITSRAGGGTGRHYVGNLE… |
| A0A3G8YMR8 | 202-370 | GDLGVAISLDAFRADVIGKLMNGGCTVLLQPDANGSTWTGKEGIYPAGQQPRDQPLAWLESSWQVTDSNQIRYAVNPMVVGNLLDMT… |
| A0A535L069 | 1-190 | None |
| A0A6N7YTB9 | 296-467 | None |
| A0A2Z4FGV6 | 349-511 | None |
| A0A524P6R3 | 70-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.