DPCstruct | MC20246
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 296 ± 76 aa |
| Standard deviation of domain lengths | 75.88 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 90.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02898 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U3YZI5 | 125-428 | LTRGPRDKPTPPDELLPQAIEFVNHYYSSFKEAKIEEHLARVEAVTKEIETTGTYLLTADELIFATKQAWRNAPRCIGRIQWSNLQV… |
| Q9Z0J4 | 318-713 | LKSTLETGCTEQICMGSIMLPSHHIRKSEDVRTKDQLFPLAKEFLDQYYSSIKRFGSKAHMDRLEEVNKEIESTSTYQLKDTELIYG… |
| A0A7R7X240 | 24-235 | None |
| S4R9W4 | 58-437 | None |
| R7UNF1 | 15-214 | None |
| F7DLC7 | 102-477 | None |
| A0A2C9K406 | 17-355 | None |
| A0A352AP46 | 325-639 | None |
| A0A1T3NPD6 | 16-383 | None |
| A0A146F810 | 348-548 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.