DPCstruct | MC20244
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 243 ± 23 aa |
| Standard deviation of domain lengths | 22.93 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 36.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0031- CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8FK49 | 185-443 | HFIEKSRKRNLEENIQEANGSEMTYVDALNHLEKSLAHLETLNHSFIVSLKNSEQEILQKYCKLYDLSRSESGKLRDQAVAMCLDGQ… |
| Q9D3Z9 | 22-254 | EEDPQEGRGSQATYPDALAHLETSLAHLETLSHSFILSLRNSEQEILQKYSYFYDLSRSEKEKIHDQAVAMCLDGQPLRMIQQLLEV… |
| A0A444UPB0 | 1-244 | None |
| A0A1S3JEJ8 | 127-351 | None |
| A0A556TZJ5 | 324-580 | None |
| A0A2P8XZZ8 | 119-411 | None |
| A0A7D9IZ48 | 3-210 | None |
| A0A5C6NPW2 | 136-345 | None |
| A0A226MV78 | 318-566 | None |
| A0A4Y2QDN4 | 332-574 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.