DPCstruct | MC2024
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 108 ± 9 aa |
| Standard deviation of domain lengths | 9.28 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20212 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B6B950 | 3-109 | ILDQNSIDIIQVDQAGQTTRLIIIDHLEWIGRKPDDEHLWQLQEKVNDYLKYIESGQLDADYPDQMGNRVVIQVYGKFDRPPAAVAF… |
| D4FS83 | 189-290 | KPTELDAIGIVDSHLELLLVDPVGWEEEIEVVHLEILQEKMNNYIHFLESKQYVARYGDKFDKKVIHIKLQYSPSDNGLAFLAAVQK… |
| A0A1F9HAF2 | 9-112 | None |
| B9XKD3 | 134-237 | None |
| A0A2V9H7U4 | 2-120 | None |
| A0A0S8F5N7 | 2-107 | None |
| A0A7Z7I5J9 | 5-107 | None |
| A0A8B6N140 | 183-295 | None |
| I8I5J7 | 272-386 | None |
| J3D2B4 | 29-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.