DPCstruct | MC20238
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 164 ± 9 aa |
| Standard deviation of domain lengths | 8.84 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 93.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C5UX91 | 16-178 | DLPWMLGAAVVGAVIAGVYGVVHDQITYAIGPEYFTNFKFHQFQGADPGLGDRVFVGTIGLLATWWVGFFAAWFLARRLIPNQPRRV… |
| A0A5B9QGN4 | 72-235 | TDVPVMMLIALRGGVIAGLYGIVHDQITYSISPEYFTRLKFEQFRYADFGLGDRVFASTIGFLATWWIGFMVAWFLARRLVADQPRD… |
| A0A150QXA4 | 2-157 | None |
| A0A098LN33 | 11-181 | None |
| A0A1M5KQC9 | 3-182 | None |
| A0A4Q2X8W7 | 2-157 | None |
| A0A5B9P9A0 | 113-272 | None |
| A0A1F5UI29 | 3-179 | None |
| A0A2E0QUG2 | 19-192 | None |
| A0A1W9X1N1 | 5-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.