DPCstruct | MC20237
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 83 ± 8 aa |
| Standard deviation of domain lengths | 8.10 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 32.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q6HJG3 | 6-88 | YVCITASGRDVTVRTPGTLHTTIKSNEKYKISELKIEGAINSADIMMLRDMAGCDAKEQRTEGRLKRIDMSGVTFVKDITPFI |
| A0A848QRA2 | 581-658 | SKTVNVEKTGSLPELISDNEKFILKELKVIGKINGTDIRFIREMAGRNEVGEPTLGSLTYLDLSDVRILEGGDWYYYD |
| F0F5J7 | 190-272 | None |
| R5PMK4 | 15-102 | None |
| A0A1G7X107 | 3-98 | None |
| I9IDP7 | 5-95 | None |
| A7AFB4 | 11-82 | None |
| R6A1H8 | 280-351 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.